Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proprotein convertase subtilisin/kexin type 5 (Pcsk5), partial

Product Specifications

Product Name Alternative

Proprotein convertase 5 Short name: PC5 Proprotein convertase 6 Short name: PC6 Subtilisin-like proprotein convertase 6 Short name: SPC6 Subtilisin/kexin-like protease PC5

Abbreviation

Recombinant Mouse Pcsk5 protein, partial

Gene Name

Pcsk5

UniProt

Q04592

Expression Region

117-452aa

Organism

Mus musculus (Mouse)

Target Sequence

DYDLSHAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAATANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSYNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSHLYGFGLMDAE

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. Likely to represent a widespread endoprotease activity within the constitutive and regulated secretory pathway. Capable of cleavage at the RX (K/R) R consensus motif. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Serine endoprotease that processes various proproteins by cleavage at paired basic amino acids, recognizing the RXXX[KR]R consensus motif. Likely functions in the constitutive and regulated secretory pathways. Plays an essential role in pregnancy establishment by proteolytic activation of a number of important factors such as BMP2, CALD1 and alpha-integrins. May be responsible for the maturation of gastrointestinal peptides. May be involved in the cellular proliferation of adrenal cortex via the activation of growth factors.

Molecular Weight

38.7 kDa

References & Citations

"The isoforms of proprotein convertase PC5 are sorted to different subcellular compartments."De Bie I., Marcinkiewicz M., Malide D., Lazure C., Nakayama K., Bendayan M., Seidah N.G.J. Cell Biol. 135:1261-1275 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

VWDE shRNA (m) Lentiviral Particles
sc-145559-V 200 µL

VWDE shRNA (m) Lentiviral Particles

Ask
View Details
Recombinant Surface presentation of antigens protein SpaQ (spaQ)
MBS1245954 Inquire

Recombinant Surface presentation of antigens protein SpaQ (spaQ)

Ask
View Details
Recombinant Rat Lipoma HMGIC fusion partner-like 1 protein (Lhfpl1)
MBS7018867-01 0.02 mg

Recombinant Rat Lipoma HMGIC fusion partner-like 1 protein (Lhfpl1)

Ask
View Details
Recombinant Rat Lipoma HMGIC fusion partner-like 1 protein (Lhfpl1)
MBS7018867-02 0.1 mg

Recombinant Rat Lipoma HMGIC fusion partner-like 1 protein (Lhfpl1)

Ask
View Details
Recombinant Rat Lipoma HMGIC fusion partner-like 1 protein (Lhfpl1)
MBS7018867-03 5x 0.1 mg

Recombinant Rat Lipoma HMGIC fusion partner-like 1 protein (Lhfpl1)

Ask
View Details
Ttbk2-set siRNA/shRNA/RNAi Lentivector (Rat)
48659096 4 x 500 ng

Ttbk2-set siRNA/shRNA/RNAi Lentivector (Rat)

Ask
View Details