Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Low-density lipoprotein receptor-related protein 2 (LRP2), partial

Product Specifications

Product Name Alternative

Glycoprotein 330 ; gp330Megalin

Abbreviation

Recombinant Human LRP2 protein, partial

Gene Name

LRP2

UniProt

P98164

Expression Region

1186-1389aa

Organism

Homo sapiens (Human)

Target Sequence

NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Immunology

Relevance

Acts together with cubilin to mediate HDL endocytosis . May participate in regulation of parathyroid-hormone and para-thyroid-hormone-related protein release.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Multiligand endocytic receptor (By similarity) . Acts together with CUBN to mediate endocytosis of high-density lipoproteins (By similarity) . Mediates receptor-mediated uptake of polybasic drugs such as aprotinin, aminoglycosides and polymyxin B (By similarity) . In the kidney, mediates the tubular uptake and clearance of leptin (By similarity) . Also mediates transport of leptin across the blood-brain barrier through endocytosis at the choroid plexus epithelium (By similarity) . Endocytosis of leptin in neuronal cells is required for hypothalamic leptin signaling and leptin-mediated regulation of feeding and body weight (By similarity) . Mediates endocytosis and subsequent lysosomal degradation of CST3 in kidney proximal tubule cells (By similarity) . Mediates renal uptake of 25-hydroxyvitamin D3 in complex with the vitamin D3 transporter GC/DBP (By similarity) . Mediates renal uptake of metallothionein-bound heavy metals

Molecular Weight

24.2 kDa

References & Citations

A protein involved in calcium sensing of the human parathyroid and placental cytotrophoblast cells belongs to the LDL-receptor protein superfamily.Lundgren S., Hjaelm G., Hellman P., Ek B., Juhlin C., Rastad J., Klareskog L., Aakerstroem G., Rask L.Exp. Cell Res. 212:344-350 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Monkey Solute Carrier Family 12 Member 2 ELISA Kit
MBS7263013-01 48 Well

Monkey Solute Carrier Family 12 Member 2 ELISA Kit

Ask
View Details
Monkey Solute Carrier Family 12 Member 2 ELISA Kit
MBS7263013-02 96 Well

Monkey Solute Carrier Family 12 Member 2 ELISA Kit

Ask
View Details
Monkey Solute Carrier Family 12 Member 2 ELISA Kit
MBS7263013-03 5x 96 Well

Monkey Solute Carrier Family 12 Member 2 ELISA Kit

Ask
View Details
Monkey Solute Carrier Family 12 Member 2 ELISA Kit
MBS7263013-04 10x 96 Well

Monkey Solute Carrier Family 12 Member 2 ELISA Kit

Ask
View Details
TNFRSF4 Antibody - middle region: FITC (ARP59086_P050-FITC)
ARP59086_P050-FITC 100 µL

TNFRSF4 Antibody - middle region: FITC (ARP59086_P050-FITC)

Ask
View Details
Anti-Human CD86/B7-2 Antibody (2331/FUN-1), FITC
FHE33831 100 Tests

Anti-Human CD86/B7-2 Antibody (2331/FUN-1), FITC

Ask
View Details