Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cystathionine beta-synthase (CBS), partial

Product Specifications

Product Name Alternative

Beta-thionase; Serine sulfhydrase

Abbreviation

Recombinant Human CBS protein, partial

Gene Name

CBS

UniProt

P35520

Expression Region

1-413aa

Organism

Homo sapiens (Human)

Target Sequence

MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLR

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Metabolism

Relevance

Only known pyridoxal phosphate-dependent enzyme that contains he. Important regulator of hydrogen sulfide, especially in the brain, utilizing cysteine instead of serine to catalyze the formation of hydrogen sulfide. Hydrogen sulfide is a gastratransmitter with signaling and cytoprotective effects such as acting as a neuromodulator in the brain to protect neurons against hypoxic injury .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine

Molecular Weight

47.4 kDa

References & Citations

Human cystathionine beta-synthase cDNA sequence, alternative splicing and expression in cultured cells.Kraus J.P., Le K., Swaroop M., Ohura T., Tahara T., Rosenberg L.E., Roper M.D., Kozich V.Hum. Mol. Genet. 2:1633-1638 (1993)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SUMO-2/3 (HSMT3, Sentrin 2, Small ubiquitin like modifier 2, Small ubiquitin like modifier protein 3, SMT3A, SMT3B, SMT3 homolog 1 (SMT3H1), SMT3 homolog 2 (SMT3H2), SMT3 homolog, SMT3 suppressor of mif two 3 homolog 1, SMT3 suppressor of mif two 3 homolo
MBS6123652-01 0.1 mL

SUMO-2/3 (HSMT3, Sentrin 2, Small ubiquitin like modifier 2, Small ubiquitin like modifier protein 3, SMT3A, SMT3B, SMT3 homolog 1 (SMT3H1), SMT3 homolog 2 (SMT3H2), SMT3 homolog, SMT3 suppressor of mif two 3 homolog 1, SMT3 suppressor of mif two 3 homolo

Ask
View Details
SUMO-2/3 (HSMT3, Sentrin 2, Small ubiquitin like modifier 2, Small ubiquitin like modifier protein 3, SMT3A, SMT3B, SMT3 homolog 1 (SMT3H1), SMT3 homolog 2 (SMT3H2), SMT3 homolog, SMT3 suppressor of mif two 3 homolog 1, SMT3 suppressor of mif two 3 homolo
MBS6123652-02 5x 0.1 mL

SUMO-2/3 (HSMT3, Sentrin 2, Small ubiquitin like modifier 2, Small ubiquitin like modifier protein 3, SMT3A, SMT3B, SMT3 homolog 1 (SMT3H1), SMT3 homolog 2 (SMT3H2), SMT3 homolog, SMT3 suppressor of mif two 3 homolog 1, SMT3 suppressor of mif two 3 homolo

Ask
View Details
ITPKC Protein Vector (Mouse) (pPM-C-HA)
25204024 500 ng

ITPKC Protein Vector (Mouse) (pPM-C-HA)

Ask
View Details
Framycetin sulfate
F017-500MG 500 mg

Framycetin sulfate

Ask
View Details
Vitronectin (VTN) (NM_000638) Human Tagged ORF Clone Lentiviral Particle
RC202929L4V 200 µL

Vitronectin (VTN) (NM_000638) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
URGCP CRISPRa sgRNA lentivector (set of three targets)(Rat)
49248126 3 x 1.0μg DNA

URGCP CRISPRa sgRNA lentivector (set of three targets)(Rat)

Ask
View Details