Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Apolipoprotein C-III (Apoc3)

Product Specifications

Product Name Alternative

Apolipoprotein C3

Abbreviation

Recombinant Rat Apoc3 protein

Gene Name

Apoc3

UniProt

P06759

Expression Region

21-101aa

Organism

Rattus norvegicus (Rat)

Target Sequence

DEGEGSLLLGSMQGYMEQASKTVQDALSSMQESDIAVVASRGWMDNRFKSLKGYWSKFTDKFTGLWESGPEDQLTTPTLEP

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assbly and secretion; Extracellular domainly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs) . Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by rnant receptors.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs) . Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.

Molecular Weight

11 kDa

References & Citations

Linkage, evolution, and expression of the rat apolipoprotein A-I, C-III, and A-IV genes.Haddad I.A., Ordovas J.M., Fitzpatrick T., Karathanasis S.K.J. Biol. Chem. 261:13268-13277 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Nin 3'UTR Lenti-reporter-Luc Vector
31834084 1.0 μg

Nin 3'UTR Lenti-reporter-Luc Vector

Ask
View Details
Goat Interleukin 10, IL-10 ELISA Kit
MBS704451-01 24 Well (LIMIT 1)

Goat Interleukin 10, IL-10 ELISA Kit

Ask
View Details
Goat Interleukin 10, IL-10 ELISA Kit
MBS704451-02 48 Well

Goat Interleukin 10, IL-10 ELISA Kit

Ask
View Details
Goat Interleukin 10, IL-10 ELISA Kit
MBS704451-03 96 Well

Goat Interleukin 10, IL-10 ELISA Kit

Ask
View Details
Goat Interleukin 10, IL-10 ELISA Kit
MBS704451-04 5x 96 Well

Goat Interleukin 10, IL-10 ELISA Kit

Ask
View Details
Goat Interleukin 10, IL-10 ELISA Kit
MBS704451-05 10x 96 Well

Goat Interleukin 10, IL-10 ELISA Kit

Ask
View Details