Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction alpha-1 protein (GJA1), partial

Product Specifications

Product Name Alternative

Connexin-43 Short name: Cx43 Gap junction 43KDA heart protein

Abbreviation

Recombinant Human GJA1 protein, partial

Gene Name

GJA1

UniProt

P17302

Expression Region

233-382aa

Organism

Homo sapiens (Human)

Target Sequence

FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Gap junction protein that acts as a regulator of bladder capacity. A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. May play a critical role in the physiology of hearing by participating in the recycling of potassium to the cochlear endolymph. Negative regulator of bladder functional capacity: acts by enhancing intercellular electrical and chemical transmission, thus sensitizing bladder muscles to cholinergic neural stimuli and causing them to contract (By similarity) . May play a role in cell growth inhibition through the regulation of NOV expression and localization. Plays an essential role in gap junction communication in the ventricles (By similarity) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.3 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs."Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Synaptopodin 2 (SYNPO2) Magnetic Fluorescence Assay Kit
MBS2160695-01 96 Tests

Synaptopodin 2 (SYNPO2) Magnetic Fluorescence Assay Kit

Ask
View Details
Synaptopodin 2 (SYNPO2) Magnetic Fluorescence Assay Kit
MBS2160695-02 5x 96 Tests

Synaptopodin 2 (SYNPO2) Magnetic Fluorescence Assay Kit

Ask
View Details
Synaptopodin 2 (SYNPO2) Magnetic Fluorescence Assay Kit
MBS2160695-03 10x 96 Tests

Synaptopodin 2 (SYNPO2) Magnetic Fluorescence Assay Kit

Ask
View Details
ATP Binding Cassette Transporter A1 (ABCA1) Human ELISA Kit
B7151 96 Tests

ATP Binding Cassette Transporter A1 (ABCA1) Human ELISA Kit

Ask
View Details
OPN4 ORF Vector (Human) (pORF)
34850011 1.0 µg DNA

OPN4 ORF Vector (Human) (pORF)

Ask
View Details