Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 3 (CXCL3)

Product Specifications

Product Name Alternative

GRO-gamma (1-73) Growth-regulated protein gamma ; GRO-gammaMacrophage inflammatory protein 2-beta ; MIP2-beta

Abbreviation

Recombinant Human CXCL3 protein

Gene Name

CXCL3

UniProt

P19876

Expression Region

35-107aa

Organism

Homo sapiens (Human)

Target Sequence

ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Ligand for CXCR2 . Has chotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma (5-73) shows a fivefold higher chotactic activity for neutrophilic granulocytes.1 Publication

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ligand for CXCR2 (By similarity) . Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma (5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes.

Molecular Weight

11.9 kDa

References & Citations

Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Yersinia pestis Acireductone dioxygenase (mtnD)
MBS1168860-01 0.02 mg (E-Coli)

Recombinant Yersinia pestis Acireductone dioxygenase (mtnD)

Ask
View Details
Recombinant Yersinia pestis Acireductone dioxygenase (mtnD)
MBS1168860-02 0.1 mg (E-Coli)

Recombinant Yersinia pestis Acireductone dioxygenase (mtnD)

Ask
View Details
Recombinant Yersinia pestis Acireductone dioxygenase (mtnD)
MBS1168860-03 0.02 mg (Yeast)

Recombinant Yersinia pestis Acireductone dioxygenase (mtnD)

Ask
View Details
Recombinant Yersinia pestis Acireductone dioxygenase (mtnD)
MBS1168860-04 0.1 mg (Yeast)

Recombinant Yersinia pestis Acireductone dioxygenase (mtnD)

Ask
View Details
Recombinant Yersinia pestis Acireductone dioxygenase (mtnD)
MBS1168860-05 0.02 mg (Baculovirus)

Recombinant Yersinia pestis Acireductone dioxygenase (mtnD)

Ask
View Details
Recombinant Yersinia pestis Acireductone dioxygenase (mtnD)
MBS1168860-06 0.02 mg (Mammalian-Cell)

Recombinant Yersinia pestis Acireductone dioxygenase (mtnD)

Ask
View Details