Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon gamma (IFNG)

Product Specifications

Product Name Alternative

Immune interferon

Abbreviation

Recombinant Human IFNG protein

Gene Name

IFNG

UniProt

P01579

Expression Region

24-161aa

Organism

Homo sapiens (Human)

Target Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

Molecular Weight

20.2 kDa

References & Citations

Chikara S.K., Jaiswal P., Sharma G.SeattleSNPs variation discovery resourceHuman protein factory for converting the transcriptome into an in vitro-expressed proteome.Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B. , Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H., Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T., Imai J., Watanabe S., Nomura N.Nat. Methods 5:1011-1017 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Prelamin-A/C, LMNA ELISA KIT
ELI-14283h 96 Tests

Human Prelamin-A/C, LMNA ELISA KIT

Ask
View Details
AE binding protein 1 (AEBP1) (NM_001129) Human Untagged Clone
SC309967 10 µg

AE binding protein 1 (AEBP1) (NM_001129) Human Untagged Clone

Ask
View Details
Human Programmed cell death protein 4, PDCD4 ELISA KIT
E4077hu-01 48 Well

Human Programmed cell death protein 4, PDCD4 ELISA KIT

Ask
View Details
Human Programmed cell death protein 4, PDCD4 ELISA KIT
E4077hu-02 96 Well

Human Programmed cell death protein 4, PDCD4 ELISA KIT

Ask
View Details
Human Programmed cell death protein 4, PDCD4 ELISA KIT
E4077hu-03 5x 96 Tests

Human Programmed cell death protein 4, PDCD4 ELISA KIT

Ask
View Details
Human Programmed cell death protein 4, PDCD4 ELISA KIT
E4077hu-04 10x 96 Tests

Human Programmed cell death protein 4, PDCD4 ELISA KIT

Ask
View Details