Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 19 (CCL19)

Product Specifications

Product Name Alternative

Beta-chemokine exodus-3CK beta-11Epstein-Barr virus-induced molecule 1 ligand chemokine ; EBI1 ligand chemokine ; ELCMacrophage inflammatory protein 3 beta ; MIP-3-beta; Small-inducible cytokine A19

Abbreviation

Recombinant Human CCL19 protein

Gene Name

CCL19

UniProt

Q99731

Expression Region

22-98aa

Organism

Homo sapiens (Human)

Target Sequence

GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chokine receptor CCR7. Recombinant CCL19 shows potent chotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4.

Molecular Weight

35.8 kDa

References & Citations

Beta-arrestin recruitment and G protein signaling by the atypical human chemokine decoy receptor CCX-CKR.Watts A.O., Verkaar F., van der Lee M.M., Timmerman C.A., Kuijer M., van Offenbeek J., van Lith L.H., Smit M.J., Leurs R., Zaman G.J., Vischer H.F.J. Biol. Chem. 288:7169-7181 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2044224-01 0.1 mL

HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Ask
View Details
HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2044224-02 0.2 mL

HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Ask
View Details
HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2044224-03 0.5 mL

HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Ask
View Details
HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2044224-04 1 mL

HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Ask
View Details
HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2044224-05 5 mL

HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Ask
View Details
HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)
MBS2044224-06 5x 5 mL

HRP-Linked Polyclonal Antibody to Interleukin 1 Beta (IL1b)

Ask
View Details