Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Store-operated calcium entry-associated regulatory factor (SARAF), partial

Product Specifications

Product Name Alternative

HBV X-transactivated gene 3 proteinHBV XAg-transactivated protein 3; Protein FOAP-7Transmembrane protein 66

Abbreviation

Recombinant Human SARAF protein, partial

Gene Name

SARAF

UniProt

Q96BY9

Expression Region

195-339aa

Organism

Homo sapiens (Human)

Target Sequence

SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Biochemicals

Relevance

Negative regulator of store-operated Ca2+ entry (SOCE) involved in protecting cells from Ca2+ overfilling. In response to cytosolic Ca2+ elevation after endoplasmic reticulum Ca2+ refilling, promotes a slow inactivation of STIM (STIM1 or STIM2) -dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca2+ levels, and thus preventing the overload of the cell with excessive Ca2+ ions.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Negative regulator of store-operated Ca (2+) entry (SOCE) involved in protecting cells from Ca (2+) overfilling. In response to cytosolic Ca (2+) elevation after endoplasmic reticulum Ca (2+) refilling, promotes a slow inactivation of STIM (STIM1 or STIM2) -dependent SOCE activity

Molecular Weight

31.5 kDa

References & Citations

Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.DNA Res. 12:117-126 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Cytoplasmic Domain

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ELP4 Antibody, FITC conjugated
A65390-100UG 100 µg

ELP4 Antibody, FITC conjugated

Ask
View Details
Ifnar1 (NM_001105893) Rat Untagged Clone
RN210225 10 µg

Ifnar1 (NM_001105893) Rat Untagged Clone

Ask
View Details
Recombinant Mouse Ghrelin O-acyltransferase (Mboat4), partial
MBS7112016 Inquire

Recombinant Mouse Ghrelin O-acyltransferase (Mboat4), partial

Ask
View Details
Canine Positive Cofactor 4 ELISA Kit
MBS753595-01 48 Well

Canine Positive Cofactor 4 ELISA Kit

Ask
View Details
Canine Positive Cofactor 4 ELISA Kit
MBS753595-02 96 Well

Canine Positive Cofactor 4 ELISA Kit

Ask
View Details
Canine Positive Cofactor 4 ELISA Kit
MBS753595-03 5x 96 Well

Canine Positive Cofactor 4 ELISA Kit

Ask
View Details