Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DCN1-like protein 1 (DCUN1D1)

Product Specifications

Product Name Alternative

DCUN1 domain-containing protein 1Defective in cullin neddylation protein 1-like protein 1Squamous cell carcinoma-related oncogene

Abbreviation

Recombinant Human DCUN1D1 protein

Gene Name

DCUN1D1

UniProt

Q96GG9

Expression Region

1-259aa

Organism

Homo sapiens (Human)

Target Sequence

MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Part of an E3 ubiquitin ligase complex for neddylation. Promotes neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes. Acts by binding to cullin-RBX1 complexes in the cytoplasm and promoting their nuclear translocation, enhancing recruitment of E2-NEDD8 (UBE2M-NEDD8) thioester to the complex, and optimizing the orientation of proteins in the complex to allow efficient transfer of NEDD8 from the E2 to the cullin substrates . Involved in the release of inhibitory effets of CAND1 on cullin-RING ligase E3 complex assbly and activity. Acts also as an oncogene facilitating malignant transformation and carcinogenic progression .1 Publication

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Part of an E3 ubiquitin ligase complex for neddylation. Promotes neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes. Acts by binding to cullin-RBX1 complexes in the cytoplasm and promoting their nuclear translocation, enhancing recruitment of E2-NEDD8 (UBE2M-NEDD8) thioester to the complex, and optimizing the orientation of proteins in the complex to allow efficient transfer of NEDD8 from the E2 to the cullin substrates

Molecular Weight

46.1 kDa

References & Citations

Squamous cell carcinoma related oncogene/DCUN1D1 is highly conserved and activated by amplification in squamous cell carcinomas.Sarkaria I., O-charoenrat P., Talbot S.G., Reddy P.G., Ngai I., Maghami E., Patel K.N., Lee B., Yonekawa Y., Dudas M., Kaufman A., Ryan R., Ghossein R., Rao P.H., Stoffel A., Ramanathan Y., Singh B.Cancer Res. 66:9437-9444 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCFD2 (Neural Stem Cell-derived Neuronal Survival Protein, Multiple Coagulation Factor Deficiency Protein 2, SDNSF, DKFZp686G21263, F5F8D, F5F8D2, LMAN1IP) (MaxLight 550)
MBS6212466-01 0.1 mL

MCFD2 (Neural Stem Cell-derived Neuronal Survival Protein, Multiple Coagulation Factor Deficiency Protein 2, SDNSF, DKFZp686G21263, F5F8D, F5F8D2, LMAN1IP) (MaxLight 550)

Sign In for Pricing
View Details
MCFD2 (Neural Stem Cell-derived Neuronal Survival Protein, Multiple Coagulation Factor Deficiency Protein 2, SDNSF, DKFZp686G21263, F5F8D, F5F8D2, LMAN1IP) (MaxLight 550)
MBS6212466-02 5x 0.1 mL

MCFD2 (Neural Stem Cell-derived Neuronal Survival Protein, Multiple Coagulation Factor Deficiency Protein 2, SDNSF, DKFZp686G21263, F5F8D, F5F8D2, LMAN1IP) (MaxLight 550)

Sign In for Pricing
View Details
PE Anti-Mouse CD80 Antibody
JOT22604F 25μg

PE Anti-Mouse CD80 Antibody

Sign In for Pricing
View Details
Mevastatin
BML-G233-0010 10 mg

Mevastatin

Sign In for Pricing
View Details
WDR13 (WD Repeat-containing Protein 13, MG21, DKFZp779C2057, FLJ20563)
138489 100 µg

WDR13 (WD Repeat-containing Protein 13, MG21, DKFZp779C2057, FLJ20563)

Sign In for Pricing
View Details
FABP4 Rabbit Polyclonal Antibody (RBITC)
orb1045883 100 µL

FABP4 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details