Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Killer cell immunoglobulin-like receptor 2DS1 (KIR2DS1), partial

Product Specifications

Product Name Alternative

CD158 antigen-like family member HMHC class I NK cell receptor Eb6 ActI; CD158h

Abbreviation

Recombinant Human KIR2DS1 protein, partial

Gene Name

KIR2DS1

UniProt

Q14954

Expression Region

22-245aa

Organism

Homo sapiens (Human)

Target Sequence

HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

Molecular Weight

28.8 kDa

References & Citations

The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Extracellular Domain

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Pig Flotillin-1 (FLOT1)
MBS1355153-01 0.02 mg (E-Coli)

Recombinant Pig Flotillin-1 (FLOT1)

Ask
View Details
Recombinant Pig Flotillin-1 (FLOT1)
MBS1355153-02 0.02 mg (Yeast)

Recombinant Pig Flotillin-1 (FLOT1)

Ask
View Details
Recombinant Pig Flotillin-1 (FLOT1)
MBS1355153-03 0.1 mg (E-Coli)

Recombinant Pig Flotillin-1 (FLOT1)

Ask
View Details
Recombinant Pig Flotillin-1 (FLOT1)
MBS1355153-04 0.1 mg (Yeast)

Recombinant Pig Flotillin-1 (FLOT1)

Ask
View Details
Recombinant Pig Flotillin-1 (FLOT1)
MBS1355153-05 0.02 mg (Baculovirus)

Recombinant Pig Flotillin-1 (FLOT1)

Ask
View Details
Recombinant Pig Flotillin-1 (FLOT1)
MBS1355153-06 0.02 mg (Mammalian-Cell)

Recombinant Pig Flotillin-1 (FLOT1)

Ask
View Details