Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Guanylate cyclase activator 2B (GUCA2B)

Product Specifications

Product Name Alternative

Guanylate cyclase C-activating peptide II ; GCAP-IIUroguanylin ; UGN

Abbreviation

Recombinant Human GUCA2B protein

Gene Name

GUCA2B

UniProt

Q16661

Expression Region

27-112aa

Organism

Homo sapiens (Human)

Target Sequence

VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.

Molecular Weight

25.5 kDa

References & Citations

Cloning and characterization of a cDNA encoding a precursor for human uroguanylin.Miyazato M., Nakazato M., Yamaguchi H., Date Y., Kojima M., Kangawa K., Matsuo H., Matsukura S.Biochem. Biophys. Res. Commun. 219:644-648 (1996)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CLEC1A (C-type Lectin Domain Family 1 Member A, C-type Lectin-like Receptor 1, CLEC-1, CLEC1, UNQ569/PRO1131, MGC34328) (MaxLight 750)
MBS6232197-01 0.1 mL

CLEC1A (C-type Lectin Domain Family 1 Member A, C-type Lectin-like Receptor 1, CLEC-1, CLEC1, UNQ569/PRO1131, MGC34328) (MaxLight 750)

Ask
View Details
CLEC1A (C-type Lectin Domain Family 1 Member A, C-type Lectin-like Receptor 1, CLEC-1, CLEC1, UNQ569/PRO1131, MGC34328) (MaxLight 750)
MBS6232197-02 5x 0.1 mL

CLEC1A (C-type Lectin Domain Family 1 Member A, C-type Lectin-like Receptor 1, CLEC-1, CLEC1, UNQ569/PRO1131, MGC34328) (MaxLight 750)

Ask
View Details
ADAM12 Polyclonal Antibody
RD84815A-01 60 μL

ADAM12 Polyclonal Antibody

Ask
View Details
ADAM12 Polyclonal Antibody
RD84815A-02 120 μL

ADAM12 Polyclonal Antibody

Ask
View Details
ADAM12 Polyclonal Antibody
RD84815A-03 200 µL

ADAM12 Polyclonal Antibody

Ask
View Details
Gpr158 (NM_001004761) Mouse Tagged Lenti ORF Clone
MR216717L4 10 µg

Gpr158 (NM_001004761) Mouse Tagged Lenti ORF Clone

Ask
View Details