Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MAP3K7 C-terminal-like protein (MAP3K7CL)

Product Specifications

Product Name Alternative

TAK1-like protein

Abbreviation

Recombinant Human MAP3K7CL protein

Gene Name

MAP3K7CL

UniProt

P57077

Expression Region

1-142aa

Organism

Homo sapiens (Human)

Target Sequence

MISTARVPADKPVRIAFSLNDASDDTPPEDSIPLVFPELDQQLQPLPPCHDSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDAAELVREFEALTEENRTLRLAQSQCVEQLEKLRIQYQKRQGSS

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.4 kDa

References & Citations

The DNA sequence of human chromosome 21.Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. , Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.Nature 405:311-319 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform D

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Manba Mouse Gene Knockout Kit (CRISPR)
KN509703 1 Kit

Manba Mouse Gene Knockout Kit (CRISPR)

Ask
View Details
p53 (Ab-378) Antibody
E11-8054B 100ug

p53 (Ab-378) Antibody

Ask
View Details
Rabbit anti-RAB1B Antibody
YLD6566-01 50 µL

Rabbit anti-RAB1B Antibody

Ask
View Details
Rabbit anti-RAB1B Antibody
YLD6566-02 100 µL

Rabbit anti-RAB1B Antibody

Ask
View Details
GPR73A (PROKR1) Human qPCR Template Standard (NM_138964)
HK211696 1 Kit

GPR73A (PROKR1) Human qPCR Template Standard (NM_138964)

Ask
View Details
Human Luteinizing Hormone-Releasing Hormone ELISA Kit
MBS3803248-01 48 Well

Human Luteinizing Hormone-Releasing Hormone ELISA Kit

Ask
View Details