Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin carboxyl-terminal hydrolase isozyme L5 (UCHL5)

Product Specifications

Product Name Alternative

Ubiquitin C-terminal hydrolase UCH37Ubiquitin thioesterase L5

Abbreviation

Recombinant Human UCHL5 protein

Gene Name

UCHL5

UniProt

Q9Y5K5

Expression Region

1-326aa

Organism

Homo sapiens (Human)

Target Sequence

MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKFEKHFEKTLLGK

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Protease that specifically cleaves 'Lys-48'-linked polyubiquitin chains. Deubiquitinating enzyme associated with the 19S regulatory subunit of the 26S proteasome. Putative regulatory component of the INO80 complex; however is inactive in the INO80 complex and is activated by a transient interaction of the INO80 complex with the proteasome via ADRM1.

Molecular Weight

53.4 kDa

References & Citations

Proteasome recruitment and activation of the Uch37 deubiquitinating enzyme by Adrm1.Yao T., Song L., Xu W., De; Martino G.N., Florens L., Swanson S.K., Washburn M.P., Conaway R.C., Conaway J.W., Cohen R.E.Nat. Cell Biol. 8:994-1002 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 4

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Brucella abortus Integration host factor subunit alpha (ihfA)
MBS1135603-01 0.02 mg (E-Coli)

Recombinant Brucella abortus Integration host factor subunit alpha (ihfA)

Ask
View Details
Recombinant Brucella abortus Integration host factor subunit alpha (ihfA)
MBS1135603-02 0.1 mg (E-Coli)

Recombinant Brucella abortus Integration host factor subunit alpha (ihfA)

Ask
View Details
Recombinant Brucella abortus Integration host factor subunit alpha (ihfA)
MBS1135603-03 0.02 mg (Yeast)

Recombinant Brucella abortus Integration host factor subunit alpha (ihfA)

Ask
View Details
Recombinant Brucella abortus Integration host factor subunit alpha (ihfA)
MBS1135603-04 0.1 mg (Yeast)

Recombinant Brucella abortus Integration host factor subunit alpha (ihfA)

Ask
View Details
Recombinant Brucella abortus Integration host factor subunit alpha (ihfA)
MBS1135603-05 0.02 mg (Baculovirus)

Recombinant Brucella abortus Integration host factor subunit alpha (ihfA)

Ask
View Details
Recombinant Brucella abortus Integration host factor subunit alpha (ihfA)
MBS1135603-06 1 mg (E-Coli)

Recombinant Brucella abortus Integration host factor subunit alpha (ihfA)

Ask
View Details