Recombinant Human S-phase kinase-associated protein 1 (SKP1)

Cyclin-A/CDK2-associated protein p19 ; p19AOrgan of Corti protein 2 ; OCP-2Organ of Corti protein II ; OCP-IIRNA polymerase II elongation factor-like protein; SIIITranscription elongation factor B polypeptide 1-likep19skp1

PSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK

Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. The functional specificity of the SCF complex depends on the F-box protein as substrate recognition component. SCF (BTRC) and SCF (FBXW11) direct ubiquitination of CTNNB1 and participate in Wnt signaling. SCF (FBXW11) directs ubiquitination of phosphorylated NFKBIA. SCF (BTRC) directs ubiquitination of NFKBIB, NFKBIE, ATF4, SMAD3, SMAD4, CDC25A, FBXO5 and probably NFKB2. SCF (SKP2) directs ubiquitination of phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S transition. SCF (SKP2) directs ubiquitination of ORC1, CDT1, RBL2, ELF4, CDKN1A, RAG2, FOXO1A, and probably MYC and TAL1. SCF (FBXW7) directs ubiquitination of cyclin E, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. SCF (FBXW2) directs ubiquitination of GCM1. SCF (FBXO32) directs ubiquitination of MYOD1. SCF (FBXO7) directs ubiquitination of BIRC2 and DLGAP5. SCF (FBXO33) directs ubiquitination of YBX1. SCF (FBXO11) directs ubiquitination of BCL6 and DTL but does not se to direct ubiquitination of TP53. SCF (BTRC) mediates the ubiquitination of NFKBIA at 'Lys-21' and 'Lys-22'; the degradation frees the associated NFKB1-RELA dimer to translocate into the nucleus and to activate transcription. SCF (CCNF) directs ubiquitination of CCP110. SCF (FBXL3) and SCF (FBXL21) direct ubiquitination of CRY1 and CRY2. SCF (FBXO9) direct ubiquitination of TTI1 and TELO2. SCF (FBXO10) direct ubiquitination of BCL2.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1. The functional specificity of the SCF complex depends on the F-box protein as substrate recognition component. SCF (BTRC) and SCF (FBXW11) direct ubiquitination of CTNNB1 and participate in Wnt signaling. SCF (FBXW11) directs ubiquitination of phosphorylated NFKBIA. SCF (BTRC) directs ubiquitination of NFKBIB, NFKBIE, ATF4, SMAD3, SMAD4, CDC25A, FBXO5, CEP68 and probably NFKB2

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.