Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RING-box protein 2 (RNF7)

Product Specifications

Product Name Alternative

CKII beta-binding protein 1 ; CKBBP1RING finger protein 7Regulator of cullins 2Sensitive to apoptosis gene protein

Abbreviation

Recombinant Human RNF7 protein

Gene Name

RNF7

UniProt

Q9UBF6

Expression Region

2-113aa

Organism

Homo sapiens (Human)

Target Sequence

ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Through the RING-type zinc finger, ses to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription

Molecular Weight

39.6 kDa

References & Citations

Protein kinase CKII interacts with and phosphorylates the SAG protein containing ring-H2 finger motif.Son M.-Y., Park J.-W., Kim Y.-S., Kang S.-W., Marshak D.R., Park W., Bae Y.-S.Biochem. Biophys. Res. Commun. 263:743-748 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD63 Antibody - middle region: HRP (ARP73782_P050-HRP)
ARP73782_P050-HRP 100 µL

CD63 Antibody - middle region: HRP (ARP73782_P050-HRP)

Ask
View Details
PE-Linked Polyclonal Antibody to Glycoprotein IX, Platelet (GP9)
MBS2039344-01 0.1 mL

PE-Linked Polyclonal Antibody to Glycoprotein IX, Platelet (GP9)

Ask
View Details
PE-Linked Polyclonal Antibody to Glycoprotein IX, Platelet (GP9)
MBS2039344-02 0.2 mL

PE-Linked Polyclonal Antibody to Glycoprotein IX, Platelet (GP9)

Ask
View Details
PE-Linked Polyclonal Antibody to Glycoprotein IX, Platelet (GP9)
MBS2039344-03 0.5 mL

PE-Linked Polyclonal Antibody to Glycoprotein IX, Platelet (GP9)

Ask
View Details
PE-Linked Polyclonal Antibody to Glycoprotein IX, Platelet (GP9)
MBS2039344-04 1 mL

PE-Linked Polyclonal Antibody to Glycoprotein IX, Platelet (GP9)

Ask
View Details
PE-Linked Polyclonal Antibody to Glycoprotein IX, Platelet (GP9)
MBS2039344-05 5 mL

PE-Linked Polyclonal Antibody to Glycoprotein IX, Platelet (GP9)

Ask
View Details