Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pregnancy zone protein (PZP), partial

Product Specifications

Product Name Alternative

C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6

Abbreviation

Recombinant Human PZP protein, partial

Gene Name

PZP

UniProt

P20742

Expression Region

472-821aa

Organism

Homo sapiens (Human)

Target Sequence

MKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGVVERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVLNYLPKCIRAEGIEQEKTFSSMTCASGANVSEQLSLKLPSNVVKESARASFSVLGDILGSAMQNIQNLLQMPYGCGEQNMVLFAPNIYVLNYLNETQQLTQEIKAKAVGYLITGYQRQLNYKHQDGSYSTFG

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme rains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced) . Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced) . Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase.

Molecular Weight

42.3 kDa

References & Citations

Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 2

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Monoclonal Antibody to 5-Hydroxytryptamine Receptor 1A (HTR1A)
MAC271Hu21-01 20 µL

Monoclonal Antibody to 5-Hydroxytryptamine Receptor 1A (HTR1A)

Ask
View Details
Monoclonal Antibody to 5-Hydroxytryptamine Receptor 1A (HTR1A)
MAC271Hu21-02 100 µL

Monoclonal Antibody to 5-Hydroxytryptamine Receptor 1A (HTR1A)

Ask
View Details
Monoclonal Antibody to 5-Hydroxytryptamine Receptor 1A (HTR1A)
MAC271Hu21-03 200 µL

Monoclonal Antibody to 5-Hydroxytryptamine Receptor 1A (HTR1A)

Ask
View Details
Monoclonal Antibody to 5-Hydroxytryptamine Receptor 1A (HTR1A)
MAC271Hu21-04 1 mL

Monoclonal Antibody to 5-Hydroxytryptamine Receptor 1A (HTR1A)

Ask
View Details
BAZ2B Antibody - middle region
MBS3201047-01 0.1 mL

BAZ2B Antibody - middle region

Ask
View Details
BAZ2B Antibody - middle region
MBS3201047-02 5x 0.1 mL

BAZ2B Antibody - middle region

Ask
View Details