Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DNA-directed RNA polymerase III subunit RPC10 (POLR3K)

Product Specifications

Product Name Alternative

DNA-directed RNA polymerase III subunit KRNA polymerase III 12.5KDA subunit ; RPC12.5RNA polymerase III subunit C11 ; HsC11p ; RPC11 ; hRPC11

Abbreviation

Recombinant Human POLR3K protein

Gene Name

POLR3K

UniProt

Q9Y2Y1

Expression Region

1-108aa

Organism

Homo sapiens (Human)

Target Sequence

MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as tplate for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway (By similarity) .

Molecular Weight

28.3 kDa

References & Citations

Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Fibroblast Growth Factor 1, Acidic / AFGF (FGF1) Antibody
abx103579-01 100 µL

Fibroblast Growth Factor 1, Acidic / AFGF (FGF1) Antibody

Ask
View Details
Fibroblast Growth Factor 1, Acidic / AFGF (FGF1) Antibody
abx103579-02 200 µL

Fibroblast Growth Factor 1, Acidic / AFGF (FGF1) Antibody

Ask
View Details
Fibroblast Growth Factor 1, Acidic / AFGF (FGF1) Antibody
abx103579-03 1 mL

Fibroblast Growth Factor 1, Acidic / AFGF (FGF1) Antibody

Ask
View Details
Human RING finger protein 24 (RNF24) ELISA Kit
abx543129 96 Tests

Human RING finger protein 24 (RNF24) ELISA Kit

Ask
View Details
Porcine CytoKeratin 19 ELISA Kit
E07C0763-01 48 Well

Porcine CytoKeratin 19 ELISA Kit

Ask
View Details
Porcine CytoKeratin 19 ELISA Kit
E07C0763-02 96 Well

Porcine CytoKeratin 19 ELISA Kit

Ask
View Details