Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PHD finger-like domain-containing protein 5A (PHF5A)

Product Specifications

Product Name Alternative

Splicing factor 3B-associated 14KDA protein ; SF3b14b

Abbreviation

Recombinant Human PHF5A protein

Gene Name

PHF5A

UniProt

Q7RTV0

Expression Region

1-110aa

Organism

Homo sapiens (Human)

Target Sequence

MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Transcription

Relevance

Acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha. Also involved in pre-mRNA splicing.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved with the PAF1 complex (PAF1C) in transcriptional elongation by RNA polymerase II, and in regulation of development and maintenance of embryonic stem cell (ESC) pluripotency. Required for maintenance of ESCs self-renewal and cellular reprogramming of stem cells. Maintains pluripotency by recruiting and stabilizing PAF1C on pluripotency genes loci, and by regulating the expression of the pluripotency genes. Regulates the deposition of elongation-associated histone modifications, including dimethylated histone H3 'Lys-79' (H3K79me2) and trimethylated histone H3 'Lys-36' (H3K36me3), on PAF1C targets, self-renewal and pluripotency genes. Regulates RNA polymerase II promoter-proximal pause release of the PAF1C targets and self-renewal genes, and the levels of elongating ('Ser-2' phosphorylated) RNA polymerase II in their gene bodies. Regulates muscle specification in adult stem cells by stabilizing PAF1C in chromatin to promote myogenic differentiation (By similarity) . Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex

Molecular Weight

39.4 kDa

References & Citations

Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MRP-L30 CRISPR Activation Plasmid (h)
sc-417650-ACT 20 µg

MRP-L30 CRISPR Activation Plasmid (h)

Ask
View Details
Recombinant Human Cadherin-related family member 3 (CDHR3), partial
MBS1333644-01 0.02 mg (E-Coli)

Recombinant Human Cadherin-related family member 3 (CDHR3), partial

Ask
View Details
Recombinant Human Cadherin-related family member 3 (CDHR3), partial
MBS1333644-02 0.02 mg (Yeast)

Recombinant Human Cadherin-related family member 3 (CDHR3), partial

Ask
View Details
Recombinant Human Cadherin-related family member 3 (CDHR3), partial
MBS1333644-03 0.1 mg (E-Coli)

Recombinant Human Cadherin-related family member 3 (CDHR3), partial

Ask
View Details
Recombinant Human Cadherin-related family member 3 (CDHR3), partial
MBS1333644-04 0.1 mg (Yeast)

Recombinant Human Cadherin-related family member 3 (CDHR3), partial

Ask
View Details
Recombinant Human Cadherin-related family member 3 (CDHR3), partial
MBS1333644-05 0.02 mg (Baculovirus)

Recombinant Human Cadherin-related family member 3 (CDHR3), partial

Ask
View Details