Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nanos homolog 2 (NANOS2)

Product Specifications

Product Name Alternative

NANO2_HUMAN; Nanos homolog 2; Nanos homolog 2 Drosophila; NANOS2; NOS-2; NOS2

Abbreviation

Recombinant Human NANOS2 protein

Gene Name

NANOS2

UniProt

P60321

Expression Region

1-138aa

Organism

Homo sapiens (Human)

Target Sequence

MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Plays a key role in the sexual differentiation of germ cells by promoting the male fate but suppressing the fale fate. Represses the fale fate pathways by suppressing meiosis, which in turn results in the promotion of the male fate. Maintains the suppression of meiosis by preventing STRA8 expression, which is required for preiotic DNA replication, after CYP26B1 is decreased. Regulates the localization of the CCR4-NOT deadenylation complex to P-bodies and plays a role in recruiting the complex to trigger the degradation of mRNAs involved in meiosis. Required for the maintenance of the spermatogonial st cell population. Not essential for the assbly of P-bodies but is required for the maintenance of their normal state .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays a key role in the sexual differentiation of germ cells by promoting the male fate but suppressing the female fate. Represses the female fate pathways by suppressing meiosis, which in turn results in the promotion of the male fate. Maintains the suppression of meiosis by preventing STRA8 expression, which is required for premeiotic DNA replication, after CYP26B1 is decreased. Regulates the localization of the CCR4-NOT deadenylation complex to P-bodies and plays a role in recruiting the complex to trigger the degradation of mRNAs involved in meiosis. Required for the maintenance of the spermatogonial stem cell population. Not essential for the assembly of P-bodies but is required for the maintenance of their normal state (By similarity) .

Molecular Weight

31.1 kDa

References & Citations

NANOS3 function in human germ cell development.Julaton V.T., Reijo Pera R.A.Hum. Mol. Genet. 20:2238-2250 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

(E,E)-Piperic Acid
sc-211392 100 mg

(E,E)-Piperic Acid

Ask
View Details
VPS13A HDR Plasmid (h)
sc-407168-HDR 20 µg

VPS13A HDR Plasmid (h)

Ask
View Details
Mouse Monoclonal MUC7 Antibody (4D2-1D7) [DyLight 755]
NBP2-50391IR 0.1 mL

Mouse Monoclonal MUC7 Antibody (4D2-1D7) [DyLight 755]

Ask
View Details
Pantothenate Kinase 2 (PANK2) Antibody
abx376224 100 µg

Pantothenate Kinase 2 (PANK2) Antibody

Ask
View Details
BTF3P5 AAV Vector (Human) (CMV)
13548101 1 μg

BTF3P5 AAV Vector (Human) (CMV)

Ask
View Details
Galc siRNA Oligos set (Rat)
21208176 3 x 5 nmol

Galc siRNA Oligos set (Rat)

Ask
View Details