Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Low-density lipoprotein receptor-related protein 4 (LRP4), partial

Product Specifications

Product Name Alternative

Multiple epidermal growth factor-like domains 7

Abbreviation

Recombinant Human LRP4 protein, partial

Gene Name

LRP4

UniProt

O75096

Expression Region

1747-1905aa

Organism

Homo sapiens (Human)

Target Sequence

YRHKKSKFTDPGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVHTAATPERRGSLPDTGWKHERKLSSESQV

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cardiovascular

Relevance

Mediates SOST-dependent inhibition of bone formation. Functions as a specific facilitator of SOST-mediated inhibition of Wnt signaling. Plays a key role in the formation and the maintenance of the neuromuscular junction (NMJ), the synapse between motor neuron and skeletal muscle. Directly binds AGRIN and recruits it to the MUSK signaling complex. Mediates the AGRIN-induced phosphorylation of MUSK, the kinase of the complex. The activation of MUSK in myotubes induces the formation of NMJ by regulating different processes including the transcription of specific genes and the clustering of AChR in the postsynaptic mbrane. Alternatively, may be involved in the negative regulation of the canonical Wnt signaling pathway, being able to antagonize the LRP6-mediated activation of this pathway. More generally, has been proposed to function as a cell surface endocytic receptor binding and internalizing Extracellular domain ligands for degradation by lysosomes.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Mediates SOST-dependent inhibition of bone formation. Functions as a specific facilitator of SOST-mediated inhibition of Wnt signaling. Plays a key role in the formation and the maintenance of the neuromuscular junction (NMJ), the synapse between motor neuron and skeletal muscle. Directly binds AGRIN and recruits it to the MUSK signaling complex. Mediates the AGRIN-induced phosphorylation of MUSK, the kinase of the complex. The activation of MUSK in myotubes induces the formation of NMJ by regulating different processes including the transcription of specific genes and the clustering of AChR in the postsynaptic membrane. Alternatively, may be involved in the negative regulation of the canonical Wnt signaling pathway, being able to antagonize the LRP6-mediated activation of this pathway. More generally, has been proposed to function as a cell surface endocytic receptor binding and internalizing extracellular ligands for degradation by lysosomes. May play an essential role in the process of digit differentiation (By similarity) .

Molecular Weight

21.9 kDa

References & Citations

Bone overgrowth-associated mutations in the LRP4 gene impair sclerostin facilitator function.Leupin O., Piters E., Halleux C., Hu S., Kramer I., Morvan F., Bouwmeester T., Schirle M., Bueno-Lozano M., Fuentes F.J., Itin P.H., Boudin E., de Freitas F., Jennes K., Brannetti B., Charara N., Ebersbach H., Geisse S. , Lu C.X., Bauer A., Van Hul W., Kneissel M.J. Biol. Chem. 286:19489-19500 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Cytoplasmic Domain

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SFRS8 Antibody - N-terminal region: HRP (ARP40524_P050-HRP)
ARP40524_P050-HRP 100 µL

SFRS8 Antibody - N-terminal region: HRP (ARP40524_P050-HRP)

Ask
View Details
NRIP2 antibody - N-terminal region
MBS3210054-01 0.1 mL

NRIP2 antibody - N-terminal region

Ask
View Details
NRIP2 antibody - N-terminal region
MBS3210054-02 5x 0.1 mL

NRIP2 antibody - N-terminal region

Ask
View Details
ING1 Antibody
A39807-100UL 100 µL

ING1 Antibody

Ask
View Details
Recombinant Rhodococcus erythropolis Translation initiation factor IF-2 (infB), partial
MBS1162399 Inquire

Recombinant Rhodococcus erythropolis Translation initiation factor IF-2 (infB), partial

Ask
View Details
pECMV-Smad9-m-FLAG Plasmid
PVT14984 2 µg

pECMV-Smad9-m-FLAG Plasmid

Ask
View Details