Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Histone H2B type 1-M (Hist1h2bm)

Product Specifications

Product Name Alternative

H2B 291B

Abbreviation

Recombinant Mouse Hist1h2bm protein

Gene Name

Hist1h2bm

UniProt

P10854

Expression Region

2-126aa

Organism

Mus musculus (Mouse)

Target Sequence

PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a tplate. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome rodeling.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Molecular Weight

17.8 kDa

References & Citations

SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z., Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.Mol. Cell 50:919-930 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal CD45 Antibody (136-4B5) [DyLight 680]
NBP3-11595FR 0.1 mL

Mouse Monoclonal CD45 Antibody (136-4B5) [DyLight 680]

Ask
View Details
PRELID3A (NM_001142406) Human Tagged ORF Clone Lentiviral Particle
RC227455L4V 200 µL

PRELID3A (NM_001142406) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Sheep Eukaryotic Translation Initiation Factor 3A ELISA Kit
E14E0047-01 48 Well

Sheep Eukaryotic Translation Initiation Factor 3A ELISA Kit

Ask
View Details
Sheep Eukaryotic Translation Initiation Factor 3A ELISA Kit
E14E0047-02 96 Well

Sheep Eukaryotic Translation Initiation Factor 3A ELISA Kit

Ask
View Details
Plant Killer Cell Lectin Like Receptor Subfamily A, Member 1 (KLRA1) ELISA Kit
MBS9371291 Inquire

Plant Killer Cell Lectin Like Receptor Subfamily A, Member 1 (KLRA1) ELISA Kit

Ask
View Details
Bovine Platelet Factor 4 (PF4) ELISA Kit
GA-E0094BV-01 48 Tests

Bovine Platelet Factor 4 (PF4) ELISA Kit

Ask
View Details