Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glucagon receptor (Gcgr), partial

Product Specifications

Product Name Alternative

GcgrGlucagon receptor; GL-R

Abbreviation

Recombinant Mouse Gcgr protein, partial

Gene Name

Gcgr

UniProt

Q61606

Expression Region

27-143aa

Organism

Mus musculus (Mouse)

Target Sequence

AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQPWRNASQCQLDDEEIEVQKGVAKMYSSQQ

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger syst.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system.

Molecular Weight

40.8 kDa

References & Citations

The glucagon receptor is required for the adaptive metabolic response to fasting.Longuet C., Sinclair E.M., Maida A., Baggio L.L., Maziarz M., Charron M.J., Drucker D.J.Cell Metab. 8:359-371 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CNOT2 Colorimetric Cell-Based ELISA Kit
EKC1125 1 Kit, containing one 96 Well Plate and all necessary reagents

CNOT2 Colorimetric Cell-Based ELISA Kit

Ask
View Details
ZNF101 Human shRNA Plasmid Kit (Locus ID 94039)
TR300299 1 Kit

ZNF101 Human shRNA Plasmid Kit (Locus ID 94039)

Ask
View Details
TRNAH9-set siRNA/shRNA/RNAi Lentivector (Human)
48080091 4 x 500 ng

TRNAH9-set siRNA/shRNA/RNAi Lentivector (Human)

Ask
View Details
TGM1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
46610154 3x1.0μg DNA

TGM1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Ask
View Details
Rabbit anti-Escherichia coli O81 (strain ED1a) rpsK Polyclonal Antibody
MBS7175666 Inquire

Rabbit anti-Escherichia coli O81 (strain ED1a) rpsK Polyclonal Antibody

Ask
View Details