Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth arrest and DNA damage-inducible protein GADD45 gamma (GADD45G)

Product Specifications

Product Name Alternative

Cytokine-responsive protein CR6DNA damage-inducible transcript 2 protein ; DDIT-2

Abbreviation

Recombinant Human GADD45G protein

Gene Name

GADD45G

UniProt

O95257

Expression Region

1-159aa

Organism

Homo sapiens (Human)

Target Sequence

MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

Tag

N-terminal 6xHis-SUMO-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK.

Molecular Weight

33.1 kDa

References & Citations

A family of stress-inducible GADD45-like proteins mediate activation of the stress-responsive MTK1/MEKK4 MAPKKK.Takekawa M., Saito H.Cell 95:521-530 (1998)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

hCG beta (CGB7) Human siRNA Oligo Duplex (Locus ID 94027)
SR314294 1 Kit

hCG beta (CGB7) Human siRNA Oligo Duplex (Locus ID 94027)

Ask
View Details
ALKBH1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B8]
TA805682AM 100 µL

ALKBH1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B8]

Ask
View Details
SREBP-2 CRISPR/Cas9 KO Plasmid (h2)
sc-400575-KO-2 20 µg

SREBP-2 CRISPR/Cas9 KO Plasmid (h2)

Ask
View Details
ITM2B, CT (ITM2B, BRI, BRI2, Integral membrane protein 2B, Immature BRI2, Protein E25B, Transmembrane protein BRI, BRI2, membrane form, Mature BRI2, BRI2 intracellular domain, BRI2C, soluble form, Bri23 peptide, ABri23, C-terminal peptide, P23 peptide) (P
MBS6311377-01 0.2 mL

ITM2B, CT (ITM2B, BRI, BRI2, Integral membrane protein 2B, Immature BRI2, Protein E25B, Transmembrane protein BRI, BRI2, membrane form, Mature BRI2, BRI2 intracellular domain, BRI2C, soluble form, Bri23 peptide, ABri23, C-terminal peptide, P23 peptide) (P

Ask
View Details
ITM2B, CT (ITM2B, BRI, BRI2, Integral membrane protein 2B, Immature BRI2, Protein E25B, Transmembrane protein BRI, BRI2, membrane form, Mature BRI2, BRI2 intracellular domain, BRI2C, soluble form, Bri23 peptide, ABri23, C-terminal peptide, P23 peptide) (P
MBS6311377-02 5x 0.2 mL

ITM2B, CT (ITM2B, BRI, BRI2, Integral membrane protein 2B, Immature BRI2, Protein E25B, Transmembrane protein BRI, BRI2, membrane form, Mature BRI2, BRI2 intracellular domain, BRI2C, soluble form, Bri23 peptide, ABri23, C-terminal peptide, P23 peptide) (P

Ask
View Details
Snrnp70 (NM_009224) Mouse Recombinant Protein
E45M43603M5 20 ug

Snrnp70 (NM_009224) Mouse Recombinant Protein

Ask
View Details